General Information

  • ID:  hor007258
  • Uniprot ID:  Q9FHA6
  • Protein name:  Protein RALF-like 34
  • Gene name:  NA
  • Organism:  Arabidopsis thaliana
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  Expressed in roots; stems and leaves.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana (Mouse-ear cress)
  • GO MF:  GO:0048046 apoplast
  • GO BP:  GO:0005179 hormone activity
  • GO CC:  GO:0019722 calcium-mediated signaling; GO:0007267 cell-cell signaling; GO:0040008 regulation of growth

Sequence Information

  • Sequence:  TKYYISYGALSANRVPCPPRSGRSYYTHNCFRARGPVHPYSRGCSSITRCRR
  • Length:  52
  • Propeptide:  MAASSLNLLLILSLLTFISLQRSESLSDNPSLTLLPDGFDWPISHSDEFDIIDGEESFEVTEEDDGVTDRRSLYWRRTKYYISYGALSANRVPCPPRSGRSYYTHNCFRARGPVHPYSRGCSSITRCRR
  • Signal peptide:  MMRGVTMVLLLPMLVWA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA